PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family B3
Protein Properties Length: 439aa    MW: 48963.3 Da    PI: 8.5426
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12746.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.27.2e-19351131197
                 HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
          B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                  +   l lpk f ++ +  k+ +  +tl+ + g +W++ +  + ++++ +++ GW++Fvk++ Lke+Df+vFk++g+s+f   v +f
  KHN12746.1  35 DQ--HLALPKAFSDNLK--KKLPENVTLKGPGGVVWNIGM--TTRDDTLYFAHGWEQFVKDHCLKENDFLVFKYNGESQF--DVLIF 113
                 33..389*****85544..558889***************..9********************************99999..77776 PP

2B339.51e-12311398494
                 E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
          B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                 v++ps+v k+  +++  + + +h ++  +s++++l+  +  +W  +++y++ ++   lt+GWk+F  +n+L+egD +vFk  g+++ ++v+
  KHN12746.1 311 VMKPSHVYKRFFVSMRGTWIGKHISP--SSQDVILRMGK-GEWIARYSYNNIRNNGGLTGGWKHFSLDNNLEEGDACVFKPAGQMNNTFVI 398
                 68899999999999999999888655..67789988855.58*******99999999***********************88877766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.47E-2220114IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.41123116IPR003340B3 DNA binding domain
CDDcd100176.55E-2125114No hitNo description
Gene3DG3DSA:2.40.330.101.5E-2225114IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.3E-1826116IPR003340B3 DNA binding domain
PfamPF023622.8E-1536113IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.8E-16307398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-13308398IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0026308406IPR003340B3 DNA binding domain
PfamPF023621.5E-10311398IPR003340B3 DNA binding domain
CDDcd100179.28E-13311404No hitNo description
PROSITE profilePS508639.319349406IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MVGQNCGGCR SWEEDIYWSH FQFLHFVQFL RADYDQHLAL PKAFSDNLKK KLPENVTLKG  60
PGGVVWNIGM TTRDDTLYFA HGWEQFVKDH CLKENDFLVF KYNGESQFDV LIFNGGSLCE  120
KAGSYFVRKC GHTGIEHAGG SLNKKRDTDN NSLEEGNIPP SNAGVECALH EKSVHANGTK  180
EPIDVPPETP PTEKTFNAGV ESSGVEQFTP DGGVTLVAVP SETANGKRIR NIVSAVKHVQ  240
TKRRGRPAKV HVRERTLDWV AALEASEPIS TSRSGTYEVY KSNRRPVTDD ETKMIESLAK  300
AACTEDSIYV VMKPSHVYKR FFVSMRGTWI GKHISPSSQD VILRMGKGEW IARYSYNNIR  360
NNGGLTGGWK HFSLDNNLEE GDACVFKPAG QMNNTFVIDM SIFRVVPETV PLTPMSRGTG  420
RRGRKQATMK SIQTQLSPP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0982360.0BT098236.1 Soybean clone JCVI-FLGm-23C7 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006601305.10.0PREDICTED: B3 domain-containing protein REM16-like
TrEMBLK7MNS40.0K7MNS4_SOYBN; Uncharacterized protein
STRINGGLYMA17G36490.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44462658
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.17e-49B3 family protein